PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy008328
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 605aa    MW: 65233 Da    PI: 7.0613
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59559084PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.64.5e-32245302260
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  Ahy008328 245 DDGYNWRKYGQKLVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 302
                8****************************************.***************85 PP

2WRKY106.11.8e-33419477159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  Ahy008328 419 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 477
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.766239303IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.6E-27241303IPR003657WRKY domain
SuperFamilySSF1182905.75E-25242303IPR003657WRKY domain
SMARTSM007742.5E-34244302IPR003657WRKY domain
PfamPF031061.1E-24245301IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-37404479IPR003657WRKY domain
SuperFamilySSF1182902.48E-29411479IPR003657WRKY domain
PROSITE profilePS5081138.825414479IPR003657WRKY domain
SMARTSM007743.1E-39419478IPR003657WRKY domain
PfamPF031063.7E-26420477IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MDSAQENSLT ELRQSSSGNA AELQSEDPNR YFPQPDAGAT SSANAGGARY KLMSPAKLPI  60
SRSPCVTIPP GLSPTSFLES PVLLSNMKVE PSPTTGSLSK LHQTGHGSVT SAAVSTTFPV  120
TTVCFNTSTV DDRTSSFFEF KAHNRSNMVN ADFNNHVNEK STQIDVQGKA PCFPSSPSVK  180
SEIAVTSNEL SLSSPVQMVS SGASSHVEVD MDEFNHGGST ASGLQASQVE SKSNGLPVAS  240
DRVSDDGYNW RKYGQKLVKG SEFPRSYYKC THPNCEVKKL FERSHDGQIT EIIYKGTHDH  300
PKPQPNRRYS AGSIMSMQDE RSDKVSFAGR DDKVSNIYGQ VSHVAEPGST PELSPGAASG  360
DSPEGAGLAS NKINDELDDD DPFSKRRKMD LGCADITPVV KPIREPRVVV QTLSEVDILD  420
DGYRWRKYGQ KVVRGNPNPR SYYKCTNAGC PVRKHVERAS HDPKAVITTY EGKHNHDVPT  480
AKNSSHDMAG QAASNKLHPL DRQELGQKKA DTISLDLGMG LNQAAENGSN GQGRVPLSEF  540
GGSQTHTSNS SFKFVHATSA PVYFGVLNNG SIPSYGSREN LSDSTSLNHS TYPCPQNMGR  600
ILTGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A5e-37231479377Probable WRKY transcription factor 4
1wj2_A5e-37231479377Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015938506.10.0PREDICTED: probable WRKY transcription factor 20
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A151S5230.0A0A151S523_CAJCA; Putative WRKY transcription factor 20
STRINGGLYMA18G09040.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein